4.13 Rating by CuteStat

kotusozluk.com is 1 decade 4 years old. It is a domain having com extension. It has a global traffic rank of #4085720 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, kotusozluk.com is SAFE to browse.

PageSpeed Score
65
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 206
Daily Pageviews: 412

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 1,940
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 6,520
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 4,085,720
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

77.92.140.32

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948
Kötü Sözlük'tü.

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: 20 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 21
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 77.92.140.32)

Tam Haber | Güncel Haberler ve Son Dakika Haberleri

- tamhaber.com.tr

Tüm sosyal medya, gazete ve internet haberleri, köşe yazarları, son dakika haberler ve halk için habercilik anlayışı ile Türkiye'nin gerçek haber sitesi.

7,102,027 $ 240.00

Index of /

- chicopeekedikopekmamalari.com
Not Applicable $ 8.95

Maya Cupcake | Harika Cupcake Çeşitleri

- mayacupcake.com

Doğumgünü, düğün ve özel gün cupcake çeşitlerimiz ile karşınızdayız.

19,998,643 $ 8.95

Index of /

- tuvalettikanikligiacmafiyatlari.net
Not Applicable $ 8.95

Sultangazi Petek Temizliği | Bir başka WordPress sitesi

- sultangazipetektemizligi.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 09 Dec 2019 02:43:41 GMT
Server: Apache/2
X-Powered-By: PHP/5.6.40
X-Pingback: http://kotusozluk.com/xmlrpc.php
Link: <http://kotusozluk.com/wp-json/>; rel="https://api.w.org/", <http://kotusozluk.com/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: Namevolcano.com LLC
Registration Date: Nov 24, 2009, 8:05 PM 1 decade 4 years 5 months ago
Expiration Date: Nov 24, 2020, 8:05 PM 3 years 5 months 20 hours ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
ns1.kotuhost.com 212.68.61.245 Türkiye Türkiye
ns2.kotuhost.com 212.68.61.231 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
kotusozluk.com A 10798 IP: 77.92.140.32
kotusozluk.com NS 14400 Target: ns1.kotuhost.com
kotusozluk.com NS 14400 Target: ns2.kotuhost.com
kotusozluk.com SOA 10798 MNAME: ns1.kotuhost.com
RNAME: mesutbilgili.outlook.com
Serial: 2019082103
Refresh: 14400
Retry: 3600
Expire: 1209600
Minimum TTL: 86400
kotusozluk.com MX 14400 Target: kotusozluk.com
kotusozluk.com TXT 14400 TXT: v=spf1 a mx ip4:212.68.61.160 ~all

Similarly Ranked Websites



Radio Limeira FM

- limeiramix.com

A rádio dos amigos

4,085,726 $ 240.00

Tata-Naka

- tatanaka.com
4,085,734 $ 240.00

Customized Automation - NKE Automation

- nke.it

NKE: automazione industriale di sistemi per l’applicazione di adesivi e sigillanti, per la marcatura VIN e la fornitura di centrali e stazioni di pompaggio.

4,085,746 $ 480.00

Full WHOIS Lookup

Domain Name: KOTUSOZLUK.COM
Registry Domain ID: 1576798361_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.isimtescil.net
Registrar URL: http://www.isimtescil.net
Updated Date: 2019-11-25T00:26:15Z
Creation Date: 2009-11-24T14:20:38Z
Registry Expiry Date: 2020-11-24T14:20:38Z
Registrar: FBS Inc.
Registrar IANA ID: 1110
Registrar Abuse Contact Email: abuse@domaintime.biz
Registrar Abuse Contact Phone: +90.8502000444
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.KOTUHOST.COM
Name Server: NS2.KOTUHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-12-09T02:48:49Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.